![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.0: automated matches [191527] (1 protein) not a true family |
![]() | Protein automated matches [190890] (7 species) not a true protein |
![]() | Species Sedum alfredii [TaxId:439688] [311437] (1 PDB entry) |
![]() | Domain d4rvpb_: 4rvp B: [309600] automated match to d3mnda_ complexed with zn |
PDB Entry: 4rvp (more details), 2.6 Å
SCOPe Domain Sequences for d4rvpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rvpb_ b.1.8.0 (B:) automated matches {Sedum alfredii [TaxId: 439688]} kkkavavlkgnsavegvvtltqeedgpttvnvritgltpgphgfhlhefgdttngcistg phfnpkglthgapedeirhagdlgnivanadgvaevtivdnqipltgpnavvgrafvvhe leddlgkgghelslstgnaggrlacgvigltpt
Timeline for d4rvpb_: