Lineage for d4rvpb_ (4rvp B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2764467Family b.1.8.0: automated matches [191527] (1 protein)
    not a true family
  6. 2764468Protein automated matches [190890] (7 species)
    not a true protein
  7. 2764492Species Sedum alfredii [TaxId:439688] [311437] (1 PDB entry)
  8. 2764494Domain d4rvpb_: 4rvp B: [309600]
    automated match to d3mnda_
    complexed with zn

Details for d4rvpb_

PDB Entry: 4rvp (more details), 2.6 Å

PDB Description: crystal structure of superoxide dismutase from sedum alfredii
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d4rvpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rvpb_ b.1.8.0 (B:) automated matches {Sedum alfredii [TaxId: 439688]}
kkkavavlkgnsavegvvtltqeedgpttvnvritgltpgphgfhlhefgdttngcistg
phfnpkglthgapedeirhagdlgnivanadgvaevtivdnqipltgpnavvgrafvvhe
leddlgkgghelslstgnaggrlacgvigltpt

SCOPe Domain Coordinates for d4rvpb_:

Click to download the PDB-style file with coordinates for d4rvpb_.
(The format of our PDB-style files is described here.)

Timeline for d4rvpb_: