SCOPe 2.06: Domain d1di0c_: 1di0 C:

Lineage for d1di0c_ (1di0 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.16: Lumazine synthase [52120] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.16.1: Lumazine synthase [52121] (2 families)

5. Family c.16.1.1: Lumazine synthase [52122] (2 proteins)

6. Protein Lumazine synthase [52123] (7 species)

7. Species Brucella abortus [TaxId:235] [52125] (2 PDB entries)

8. Domain d1di0c_: 1di0 C: [30959]
   complexed with po4

Details for d1di0c_

PDB Entry: 1di0, 2.7 Å

PDB Description: crystal structure of lumazine synthase from brucella abortus

PDB Compounds: (C:) lumazine synthase

SCOPe Domain Sequences for d1di0c_:

Sequence; same for both SEQRES and ATOM records:

>d1di0c_ c.16.1.1 (C:) Lumazine synthase {Brucella abortus [TaxId: 235]}
sfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartgr
yaaivgaafvidggiydhdfvatavingmmqvqletevpvlsvvltphhfheskehhdff
hahfkvkgveaahaalqivsersria

Timeline for d1di0c_:

• d1di0c_ first appeared (with stable ids) in SCOP 1.55
  
• d1di0c_ appears in SCOPe 2.05
  
• d1di0c_ appears in SCOPe 2.07
  
• d1di0c_ appears in the current release, SCOPe 2.08