| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (2 families) ![]() |
| Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
| Protein Lumazine synthase [52123] (7 species) |
| Species Brucella abortus [TaxId:235] [52125] (2 PDB entries) |
| Domain d1di0c_: 1di0 C: [30959] complexed with po4 |
PDB Entry: 1di0 (more details), 2.7 Å
SCOPe Domain Sequences for d1di0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1di0c_ c.16.1.1 (C:) Lumazine synthase {Brucella abortus [TaxId: 235]}
sfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartgr
yaaivgaafvidggiydhdfvatavingmmqvqletevpvlsvvltphhfheskehhdff
hahfkvkgveaahaalqivsersria
Timeline for d1di0c_:
View in 3DDomains from other chains: (mouse over for more information) d1di0a_, d1di0b_, d1di0d_, d1di0e_ |