| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins) adopts thermolysin-like fold |
| Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [64340] (58 PDB entries) Uniprot P09960 |
| Domain d4rvba2: 4rvb A:209-460 [309589] Other proteins in same PDB: d4rvba1, d4rvba3 automated match to d3u9wa2 complexed with act, acy, gol, imd, yb, zn |
PDB Entry: 4rvb (more details), 1.93 Å
SCOPe Domain Sequences for d4rvba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rvba2 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny
Timeline for d4rvba2: