Lineage for d4rv6d2 (4rv6 D:797-1010)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558127Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2558128Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2558416Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2558417Protein automated matches [191197] (9 species)
    not a true protein
  7. 2558470Species Human (Homo sapiens) [TaxId:9606] [225406] (41 PDB entries)
  8. 2558542Domain d4rv6d2: 4rv6 D:797-1010 [309585]
    Other proteins in same PDB: d4rv6a1, d4rv6b1, d4rv6c1, d4rv6d1
    automated match to d4hhyd2
    complexed with rpb, so4

Details for d4rv6d2

PDB Entry: 4rv6 (more details), 3.19 Å

PDB Description: human artd1 (parp1) catalytic domain in complex with inhibitor rucaparib
PDB Compounds: (D:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4rv6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rv6d2 d.166.1.0 (D:797-1010) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfk

SCOPe Domain Coordinates for d4rv6d2:

Click to download the PDB-style file with coordinates for d4rv6d2.
(The format of our PDB-style files is described here.)

Timeline for d4rv6d2: