Lineage for d4rv6d1 (4rv6 D:662-796)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712204Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2712205Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2712230Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2712231Protein automated matches [226964] (2 species)
    not a true protein
  7. 2712235Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries)
  8. 2712362Domain d4rv6d1: 4rv6 D:662-796 [309584]
    Other proteins in same PDB: d4rv6a2, d4rv6b2, d4rv6c2, d4rv6d2
    automated match to d4hhyd1
    complexed with rpb, so4

Details for d4rv6d1

PDB Entry: 4rv6 (more details), 3.19 Å

PDB Description: human artd1 (parp1) catalytic domain in complex with inhibitor rucaparib
PDB Compounds: (D:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4rv6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rv6d1 a.41.1.0 (D:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
sddsskdpidvnyek

SCOPe Domain Coordinates for d4rv6d1:

Click to download the PDB-style file with coordinates for d4rv6d1.
(The format of our PDB-style files is described here.)

Timeline for d4rv6d1: