Lineage for d1di0b_ (1di0 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2113861Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2113862Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2113863Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2113864Protein Lumazine synthase [52123] (7 species)
  7. 2113938Species Brucella abortus [TaxId:235] [52125] (2 PDB entries)
  8. 2113940Domain d1di0b_: 1di0 B: [30958]
    complexed with po4

Details for d1di0b_

PDB Entry: 1di0 (more details), 2.7 Å

PDB Description: crystal structure of lumazine synthase from brucella abortus
PDB Compounds: (B:) lumazine synthase

SCOPe Domain Sequences for d1di0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1di0b_ c.16.1.1 (B:) Lumazine synthase {Brucella abortus [TaxId: 235]}
tsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartg
ryaaivgaafvidggiydhdfvatavingmmqvqletevpvlsvvltphhfheskehhdf
fhahfkvkgveaahaalqivsersriaa

SCOPe Domain Coordinates for d1di0b_:

Click to download the PDB-style file with coordinates for d1di0b_.
(The format of our PDB-style files is described here.)

Timeline for d1di0b_: