Lineage for d4rv0e1 (4rv0 E:20-103)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070519Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2070582Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2070784Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 2070785Protein automated matches [191195] (7 species)
    not a true protein
  7. 2070804Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311438] (1 PDB entry)
  8. 2070807Domain d4rv0e1: 4rv0 E:20-103 [309572]
    Other proteins in same PDB: d4rv0a2, d4rv0a3, d4rv0c2, d4rv0c3, d4rv0e2, d4rv0e3, d4rv0g2, d4rv0g3
    automated match to d3qq7a1
    complexed with so4

Details for d4rv0e1

PDB Entry: 4rv0 (more details), 2 Å

PDB Description: crystal structure of tn complex
PDB Compounds: (E:) Transitional endoplasmic reticulum ATPase TER94

SCOPe Domain Sequences for d4rv0e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rv0e1 b.52.2.0 (E:20-103) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pnrliveeaqnddnsvvslsqakmdelqlfrgdtvilkgkrrketvcivlsddtcpdeki
rmnrvvrnnlcvhlsdvvsvqscp

SCOPe Domain Coordinates for d4rv0e1:

Click to download the PDB-style file with coordinates for d4rv0e1.
(The format of our PDB-style files is described here.)

Timeline for d4rv0e1: