Class b: All beta proteins [48724] (177 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.0: automated matches [191648] (1 protein) not a true family |
Protein automated matches [191195] (7 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311438] (1 PDB entry) |
Domain d4rv0e1: 4rv0 E:20-103 [309572] Other proteins in same PDB: d4rv0a2, d4rv0a3, d4rv0c2, d4rv0c3, d4rv0e2, d4rv0e3, d4rv0g2, d4rv0g3 automated match to d3qq7a1 complexed with so4 |
PDB Entry: 4rv0 (more details), 2 Å
SCOPe Domain Sequences for d4rv0e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rv0e1 b.52.2.0 (E:20-103) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} pnrliveeaqnddnsvvslsqakmdelqlfrgdtvilkgkrrketvcivlsddtcpdeki rmnrvvrnnlcvhlsdvvsvqscp
Timeline for d4rv0e1: