| Class b: All beta proteins [48724] (178 folds) |
| Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
| Family b.52.2.0: automated matches [191648] (1 protein) not a true family |
| Protein automated matches [191195] (10 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311438] (1 PDB entry) |
| Domain d4rv0c1: 4rv0 C:20-103 [309569] Other proteins in same PDB: d4rv0a2, d4rv0a3, d4rv0c2, d4rv0c3, d4rv0e2, d4rv0e3, d4rv0g2, d4rv0g3 automated match to d3qq7a1 complexed with so4 |
PDB Entry: 4rv0 (more details), 2 Å
SCOPe Domain Sequences for d4rv0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rv0c1 b.52.2.0 (C:20-103) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pnrliveeaqnddnsvvslsqakmdelqlfrgdtvilkgkrrketvcivlsddtcpdeki
rmnrvvrnnlcvhlsdvvsvqscp
Timeline for d4rv0c1: