Lineage for d1rvv1_ (1rvv 1:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854558Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2854559Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2854560Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2854561Protein Lumazine synthase [52123] (7 species)
  7. 2854588Species Bacillus subtilis [TaxId:1423] [52124] (2 PDB entries)
    beta-subunit of the lumazine synthase/riboflavin synthase complex; 60 subunits form an icosahedral shell
  8. 2854589Domain d1rvv1_: 1rvv 1: [30953]
    complexed with ini, po4

Details for d1rvv1_

PDB Entry: 1rvv (more details), 2.4 Å

PDB Description: synthase/riboflavin synthase complex of bacillus subtilis
PDB Compounds: (1:) riboflavin synthase

SCOPe Domain Sequences for d1rvv1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvv1_ c.16.1.1 (1:) Lumazine synthase {Bacillus subtilis [TaxId: 1423]}
mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
ieqaieragtkagnkgvdcavsaiemanlnrsfe

SCOPe Domain Coordinates for d1rvv1_:

Click to download the PDB-style file with coordinates for d1rvv1_.
(The format of our PDB-style files is described here.)

Timeline for d1rvv1_: