Lineage for d4rrqb_ (4rrq B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920849Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2920850Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2920866Family c.110.1.2: Archaea-specific editing domain of threonyl-tRNA synthetase (Pab-NTD) [310661] (2 proteins)
    Pfam PF08915
  6. 2920874Protein automated matches [310853] (2 species)
    not a true protein
  7. 2920875Species Pyrococcus abyssi [TaxId:272844] [311435] (8 PDB entries)
  8. 2920877Domain d4rrqb_: 4rrq B: [309519]
    automated match to d1y2qa_
    complexed with a3s; mutant

Details for d4rrqb_

PDB Entry: 4rrq (more details), 1.79 Å

PDB Description: k121m mutant of n-terminal editing domain of threonyl-trna synthetase from pyrococcus abyssi with l-ser3aa
PDB Compounds: (B:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4rrqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rrqb_ c.110.1.2 (B:) automated matches {Pyrococcus abyssi [TaxId: 272844]}
mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
mafkisckghplaelsrtivpeearve

SCOPe Domain Coordinates for d4rrqb_:

Click to download the PDB-style file with coordinates for d4rrqb_.
(The format of our PDB-style files is described here.)

Timeline for d4rrqb_: