SCOPe 2.08: Domain d4rrqb_: 4rrq B:

Lineage for d4rrqb_ (4rrq B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.110: DTD-like [69499] (1 superfamily)
   beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC

4. Superfamily c.110.1: DTD-like [69500] (3 families)
   active form is a dimer

5. Family c.110.1.2: Archaea-specific editing domain of threonyl-tRNA synthetase (Pab-NTD) [310661] (2 proteins)
   Pfam PF08915

6. Protein automated matches [310853] (2 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:272844] [311435] (8 PDB entries)

8. Domain d4rrqb_: 4rrq B: [309519]
   automated match to d1y2qa_
   complexed with a3s; mutant

Details for d4rrqb_

PDB Entry: 4rrq, 1.79 Å

PDB Description: k121m mutant of n-terminal editing domain of threonyl-trna synthetase from pyrococcus abyssi with l-ser3aa

PDB Compounds: (B:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4rrqb_:

Sequence; same for both SEQRES and ATOM records:

>d4rrqb_ c.110.1.2 (B:) automated matches {Pyrococcus abyssi [TaxId: 272844]}
mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
mafkisckghplaelsrtivpeearve

Timeline for d4rrqb_:

• d4rrqb_ first appeared in SCOPe 2.06
  
• d4rrqb_ appears in SCOPe 2.07