Lineage for d4rrja_ (4rrj A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2168191Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2168192Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2168239Family c.110.1.0: automated matches [191422] (1 protein)
    not a true family
  6. 2168240Protein automated matches [190596] (5 species)
    not a true protein
  7. 2168241Species Aeropyrum pernix [TaxId:272557] [311433] (14 PDB entries)
  8. 2168252Domain d4rrja_: 4rrj A: [309510]
    automated match to d1y2qa_
    complexed with a3s; mutant

Details for d4rrja_

PDB Entry: 4rrj (more details), 1.86 Å

PDB Description: y115a mutant of n-terminal editing domain of threonyl-trna synthetase from aeropyrum pernix with l-ser3aa
PDB Compounds: (A:) Probable threonine--tRNA ligase 2

SCOPe Domain Sequences for d4rrja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rrja_ c.110.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
mrllylhadrfeyktvkpalknppdppgeasfgealvvfttvedgdgpqtvmyaasdias
hssrlkvttvilypyahlssrlakpmaahkrlielegalrtkfpghvhrapfgwaksfsi
ackghplaelsrsfte

SCOPe Domain Coordinates for d4rrja_:

Click to download the PDB-style file with coordinates for d4rrja_.
(The format of our PDB-style files is described here.)

Timeline for d4rrja_: