SCOPe 2.06: Domain d4rria_: 4rri A:

Lineage for d4rria_ (4rri A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.110: DTD-like [69499] (1 superfamily)
   beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC

4. Superfamily c.110.1: DTD-like [69500] (3 families)
   active form is a dimer

5. Family c.110.1.0: automated matches [191422] (1 protein)
   not a true family

6. Protein automated matches [190596] (5 species)
   not a true protein

7. Species Aeropyrum pernix [TaxId:272557] [311433] (14 PDB entries)

8. Domain d4rria_: 4rri A: [309509]
   automated match to d1y2qa_
   complexed with a3t, mg; mutant

Details for d4rria_

PDB Entry: 4rri, 1.5 Å

PDB Description: k116m mutant of n-terminal editing domain of threonyl-trna synthetase from aeropyrum pernix with l-thr3aa

PDB Compounds: (A:) Probable threonine--tRNA ligase 2

SCOPe Domain Sequences for d4rria_:

Sequence; same for both SEQRES and ATOM records:

>d4rria_ c.110.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
mrllylhadrfeyktvkpalknppdppgeasfgealvvfttvedgdgpqtvmyaasdias
hssrlkvttvilypyahlssrlakpmaahkrlielegalrtkfpghvhrapfgwymsfsi
ackghplaelsrsfte

Timeline for d4rria_:

• d4rria_ is new in SCOPe 2.06-stable
  
• d4rria_ appears in SCOPe 2.07
  
• d4rria_ appears in the current release, SCOPe 2.08