Lineage for d4rrgc_ (4rrg C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920849Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2920850Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2920897Family c.110.1.0: automated matches [191422] (1 protein)
    not a true family
  6. 2920898Protein automated matches [190596] (6 species)
    not a true protein
  7. 2920921Species Methanocaldococcus jannaschii [TaxId:243232] [311434] (2 PDB entries)
  8. 2920930Domain d4rrgc_: 4rrg C: [309506]
    automated match to d1y2qa_
    complexed with a3t

Details for d4rrgc_

PDB Entry: 4rrg (more details), 1.93 Å

PDB Description: editing domain of threonyl-trna synthetase from methanococcus jannaschii with l-thr3aa
PDB Compounds: (C:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4rrgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rrgc_ c.110.1.0 (C:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mkmllihsdylefeakektkiaeetenlkgkldeclacfiaveredennpegtaigavee
iekvanqlkvnnivvypyahlssdlsspetavkvlkdiesilkergynvlrapfgwykaf
kisckghplselsrkiv

SCOPe Domain Coordinates for d4rrgc_:

Click to download the PDB-style file with coordinates for d4rrgc_.
(The format of our PDB-style files is described here.)

Timeline for d4rrgc_: