![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.110: DTD-like [69499] (1 superfamily) beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC |
![]() | Superfamily c.110.1: DTD-like [69500] (3 families) ![]() active form is a dimer |
![]() | Family c.110.1.0: automated matches [191422] (1 protein) not a true family |
![]() | Protein automated matches [190596] (6 species) not a true protein |
![]() | Species Methanocaldococcus jannaschii [TaxId:243232] [311434] (2 PDB entries) |
![]() | Domain d4rrgc_: 4rrg C: [309506] automated match to d1y2qa_ complexed with a3t |
PDB Entry: 4rrg (more details), 1.93 Å
SCOPe Domain Sequences for d4rrgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rrgc_ c.110.1.0 (C:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]} mkmllihsdylefeakektkiaeetenlkgkldeclacfiaveredennpegtaigavee iekvanqlkvnnivvypyahlssdlsspetavkvlkdiesilkergynvlrapfgwykaf kisckghplselsrkiv
Timeline for d4rrgc_: