| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.110: DTD-like [69499] (1 superfamily) beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC |
Superfamily c.110.1: DTD-like [69500] (3 families) ![]() active form is a dimer |
| Family c.110.1.0: automated matches [191422] (1 protein) not a true family |
| Protein automated matches [190596] (6 species) not a true protein |
| Species Methanocaldococcus jannaschii [TaxId:243232] [311434] (2 PDB entries) |
| Domain d4rrff_: 4rrf F: [309503] automated match to d1y2qa_ complexed with a3s, cl, mg |
PDB Entry: 4rrf (more details), 1.7 Å
SCOPe Domain Sequences for d4rrff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rrff_ c.110.1.0 (F:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mkmllihsdylefeakektkiaeetenlkgkldeclacfiaveredennpegtaigavee
iekvanqlkvnnivvypyahlssdlsspetavkvlkdiesilkergynvlrapfgwykaf
kisckghplselsrkivake
Timeline for d4rrff_: