Lineage for d1rvvx_ (1rvv X:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67948Fold c.16: Lumazine synthase [52120] (1 superfamily)
  4. 67949Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 67950Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 67951Protein Lumazine synthase [52123] (5 species)
  7. 67952Species Bacillus subtilis [TaxId:1423] [52124] (1 PDB entry)
  8. 67980Domain d1rvvx_: 1rvv X: [30950]

Details for d1rvvx_

PDB Entry: 1rvv (more details), 2.4 Å

PDB Description: synthase/riboflavin synthase complex of bacillus subtilis

SCOP Domain Sequences for d1rvvx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvvx_ c.16.1.1 (X:) Lumazine synthase {Bacillus subtilis}
mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
ieqaieragtkagnkgvdcavsaiemanlnrsfe

SCOP Domain Coordinates for d1rvvx_:

Click to download the PDB-style file with coordinates for d1rvvx_.
(The format of our PDB-style files is described here.)

Timeline for d1rvvx_: