Lineage for d4rndd_ (4rnd D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923689Fold c.149: AtpF-like [159467] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2923690Superfamily c.149.1: AtpF-like [159468] (2 families) (S)
    automatically mapped to Pfam PF01990
  5. 2923691Family c.149.1.1: AtpF-like [159469] (2 proteins)
    Pfam PF01990; segment-swapping in some members
  6. 2923703Protein automated matches [190584] (2 species)
    not a true protein
  7. 2923704Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [311432] (1 PDB entry)
  8. 2923706Domain d4rndd_: 4rnd D: [309479]
    automated match to d3j9tn_
    complexed with gol

Details for d4rndd_

PDB Entry: 4rnd (more details), 3.18 Å

PDB Description: Crystal Structure of the subunit DF-assembly of the eukaryotic V-ATPase.
PDB Compounds: (D:) V-type proton ATPase subunit F

SCOPe Domain Sequences for d4rndd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rndd_ c.149.1.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
aekrtliaviadedtttglllagigqitpetqeknffvyqegkttkeeitdkfnhfteer
ddiaillinqhiaenirarvdsftnafpaileipskdhpydpekdsvlkrvrklf

SCOPe Domain Coordinates for d4rndd_:

Click to download the PDB-style file with coordinates for d4rndd_.
(The format of our PDB-style files is described here.)

Timeline for d4rndd_: