SCOPe 2.06: Domain d4rndb_: 4rnd B:

Lineage for d4rndb_ (4rnd B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.149: AtpF-like [159467] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.149.1: AtpF-like [159468] (1 family)
   automatically mapped to Pfam PF01990

5. Family c.149.1.1: AtpF-like [159469] (2 proteins)
   Pfam PF01990; segment-swapping in some members

6. Protein automated matches [190584] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [311432] (1 PDB entry)

8. Domain d4rndb_: 4rnd B: [309478]
   automated match to d3j9tn_
   complexed with gol

Details for d4rndb_

PDB Entry: 4rnd, 3.18 Å

PDB Description: Crystal Structure of the subunit DF-assembly of the eukaryotic V-ATPase.

PDB Compounds: (B:) V-type proton ATPase subunit F

SCOPe Domain Sequences for d4rndb_:

Sequence; same for both SEQRES and ATOM records:

>d4rndb_ c.149.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
maekrtliaviadedtttglllagigqitpetqeknffvyqegkttkeeitdkfnhftee
rddiaillinqhiaenirarvdsftnafpaileipskdhpydpekdsvlkrvrklfge

Timeline for d4rndb_:

• d4rndb_ is new in SCOPe 2.06-stable
  
• d4rndb_ appears in SCOPe 2.07
  
• d4rndb_ appears in the current release, SCOPe 2.08