Lineage for d4rndb_ (4rnd B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2170640Fold c.149: AtpF-like [159467] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2170641Superfamily c.149.1: AtpF-like [159468] (1 family) (S)
    automatically mapped to Pfam PF01990
  5. 2170642Family c.149.1.1: AtpF-like [159469] (2 proteins)
    Pfam PF01990; segment-swapping in some members
  6. 2170654Protein automated matches [190584] (2 species)
    not a true protein
  7. 2170655Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [311432] (1 PDB entry)
  8. 2170656Domain d4rndb_: 4rnd B: [309478]
    automated match to d3j9tn_
    complexed with gol

Details for d4rndb_

PDB Entry: 4rnd (more details), 3.18 Å

PDB Description: Crystal Structure of the subunit DF-assembly of the eukaryotic V-ATPase.
PDB Compounds: (B:) V-type proton ATPase subunit F

SCOPe Domain Sequences for d4rndb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rndb_ c.149.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
maekrtliaviadedtttglllagigqitpetqeknffvyqegkttkeeitdkfnhftee
rddiaillinqhiaenirarvdsftnafpaileipskdhpydpekdsvlkrvrklfge

SCOPe Domain Coordinates for d4rndb_:

Click to download the PDB-style file with coordinates for d4rndb_.
(The format of our PDB-style files is described here.)

Timeline for d4rndb_: