SCOPe 2.08: Domain d4rnaa2: 4rna A:62-322

Lineage for d4rnaa2 (4rna A:62-322)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein Papain-like protease PLpro, catalytic domain [310795] (4 species)

7. Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311055] (7 PDB entries)

8. Domain d4rnaa2: 4rna A:62-322 [309477]
   Other proteins in same PDB: d4rnaa1
   automated match to d4p16a2
   complexed with po4, zn

Details for d4rnaa2

PDB Entry: 4rna, 1.79 Å

PDB Description: crystal structure of plpro from middle east respiratory syndrome (mers) coronavirus

PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d4rnaa2:

Sequence; same for both SEQRES and ATOM records:

>d4rnaa2 d.3.1.23 (A:62-322) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyssdcn

Timeline for d4rnaa2:

• d4rnaa2 first appeared in SCOPe 2.06
  
• d4rnaa2 appears in SCOPe 2.07