SCOPe 2.08: Domain d4rnaa1: 4rna A:2-61

Lineage for d4rnaa1 (4rna A:2-61)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311415] (6 PDB entries)

8. Domain d4rnaa1: 4rna A:2-61 [309476]
   Other proteins in same PDB: d4rnaa2
   automated match to d4p16a1
   complexed with po4, zn

Details for d4rnaa1

PDB Entry: 4rna, 1.79 Å

PDB Description: crystal structure of plpro from middle east respiratory syndrome (mers) coronavirus

PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d4rnaa1:

Sequence; same for both SEQRES and ATOM records:

>d4rnaa1 d.15.1.0 (A:2-61) automated matches {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt

Timeline for d4rnaa1:

• d4rnaa1 first appeared in SCOPe 2.06
  
• d4rnaa1 appears in SCOPe 2.07