Lineage for d4rmab1 (4rma B:2-87)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933242Domain d4rmab1: 4rma B:2-87 [309473]
    Other proteins in same PDB: d4rmaa2, d4rmaa3, d4rmab2, d4rmab3
    automated match to d1gc7a3
    complexed with so4

Details for d4rmab1

PDB Entry: 4rma (more details), 1.75 Å

PDB Description: crystal structure of the ferm domain of human ezrin
PDB Compounds: (B:) Ezrin

SCOPe Domain Sequences for d4rmab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rmab1 d.15.1.0 (B:2-87) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkpinvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwyfglhyvdnkgfptwlkl
dkkvsaqevrkenplqfkfrakfype

SCOPe Domain Coordinates for d4rmab1:

Click to download the PDB-style file with coordinates for d4rmab1.
(The format of our PDB-style files is described here.)

Timeline for d4rmab1: