SCOPe 2.06: Domain d4rmaa2: 4rma A:88-198

Lineage for d4rmaa2 (4rma A:88-198)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.0: automated matches [254193] (1 protein)
   not a true family

6. Protein automated matches [254423] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255207] (7 PDB entries)

8. Domain d4rmaa2: 4rma A:88-198 [309471]
   Other proteins in same PDB: d4rmaa1, d4rmaa3, d4rmab1, d4rmab3
   automated match to d2zpya1
   complexed with so4

Details for d4rmaa2

PDB Entry: 4rma, 1.75 Å

PDB Description: crystal structure of the ferm domain of human ezrin

PDB Compounds: (A:) Ezrin

SCOPe Domain Sequences for d4rmaa2:

Sequence; same for both SEQRES and ATOM records:

>d4rmaa2 a.11.2.0 (A:88-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvaeeliqditqklfflqvkegilsdeiycppetavllgsyavqakfgdynkevhksgyl
sserlipqrvmdqhkltrdqwedriqvwhaehrgmlkdnamleylkiaqdl

Timeline for d4rmaa2:

• d4rmaa2 is new in SCOPe 2.06-stable
  
• d4rmaa2 appears in SCOPe 2.07
  
• d4rmaa2 appears in the current release, SCOPe 2.08