| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) ![]() automatically mapped to Pfam PF01701 |
| Family f.23.18.0: automated matches [276196] (1 protein) not a true family |
| Protein automated matches [276198] (5 species) not a true protein |
| Species Pea (Pisum sativum) [TaxId:3888] [276201] (9 PDB entries) |
| Domain d4rkuj_: 4rku J: [309469] Other proteins in same PDB: d4rku1_, d4rku3_, d4rku4_, d4rkua_, d4rkub_, d4rkuc_, d4rkud_, d4rkue_, d4rkuf_, d4rkul_ automated match to d4y28j_ complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4 |
PDB Entry: 4rku (more details), 3 Å
SCOPe Domain Sequences for d4rkuj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rkuj_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
rdlktylsvapvastlwfaalagllieinrlfpdaltfpf
Timeline for d4rkuj_: