Lineage for d4rkuj_ (4rku J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026183Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 3026208Family f.23.18.0: automated matches [276196] (1 protein)
    not a true family
  6. 3026209Protein automated matches [276198] (5 species)
    not a true protein
  7. 3026223Species Pea (Pisum sativum) [TaxId:3888] [276201] (9 PDB entries)
  8. 3026232Domain d4rkuj_: 4rku J: [309469]
    Other proteins in same PDB: d4rku1_, d4rku3_, d4rku4_, d4rkua_, d4rkub_, d4rkuc_, d4rkud_, d4rkue_, d4rkuf_, d4rkul_
    automated match to d4y28j_
    complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4

Details for d4rkuj_

PDB Entry: 4rku (more details), 3 Å

PDB Description: Crystal structure of plant Photosystem I at 3 Angstrom resolution
PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d4rkuj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rkuj_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
rdlktylsvapvastlwfaalagllieinrlfpdaltfpf

SCOPe Domain Coordinates for d4rkuj_:

Click to download the PDB-style file with coordinates for d4rkuj_.
(The format of our PDB-style files is described here.)

Timeline for d4rkuj_: