SCOPe 2.06: Domain d4rkue_: 4rku E:

Lineage for d4rkue_ (4rku E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.0: automated matches [191659] (1 protein)
   not a true family

6. Protein automated matches [191237] (4 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [311431] (3 PDB entries)

8. Domain d4rkue_: 4rku E: [309467]
   Other proteins in same PDB: d4rku3_, d4rku4_, d4rkua_, d4rkub_, d4rkuc_, d4rkud_, d4rkuf_, d4rkuj_
   automated match to d4y28e_
   complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4

Details for d4rkue_

PDB Entry: 4rku, 3 Å

PDB Description: Crystal structure of plant Photosystem I at 3 Angstrom resolution

PDB Compounds: (E:) Photosystem I reaction center subunit IV B, chloroplastic

SCOPe Domain Sequences for d4rkue_:

Sequence; same for both SEQRES and ATOM records:

>d4rkue_ b.34.4.0 (E:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
pigpkrgakvkilrqesywykgtgsvvtvdqdpntrypvvvrfnkvnyanvstnnyalde
vee

Timeline for d4rkue_:

• d4rkue_ is new in SCOPe 2.06-stable
  
• d4rkue_ appears in SCOPe 2.07
  
• d4rkue_ appears in the current release, SCOPe 2.08