Lineage for d4rkue_ (4rku E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783857Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2783858Protein automated matches [191237] (8 species)
    not a true protein
  7. 2783905Species Pea (Pisum sativum) [TaxId:3888] [311431] (8 PDB entries)
  8. 2783913Domain d4rkue_: 4rku E: [309467]
    Other proteins in same PDB: d4rku1_, d4rku3_, d4rku4_, d4rkua_, d4rkub_, d4rkuc_, d4rkud_, d4rkuf_, d4rkuj_, d4rkul_
    automated match to d4y28e_
    complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4

Details for d4rkue_

PDB Entry: 4rku (more details), 3 Å

PDB Description: Crystal structure of plant Photosystem I at 3 Angstrom resolution
PDB Compounds: (E:) Photosystem I reaction center subunit IV B, chloroplastic

SCOPe Domain Sequences for d4rkue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rkue_ b.34.4.0 (E:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
pigpkrgakvkilrqesywykgtgsvvtvdqdpntrypvvvrfnkvnyanvstnnyalde
vee

SCOPe Domain Coordinates for d4rkue_:

Click to download the PDB-style file with coordinates for d4rkue_.
(The format of our PDB-style files is described here.)

Timeline for d4rkue_: