Lineage for d4rkud_ (4rku D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005547Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 3005548Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 3005549Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 3005562Protein automated matches [236562] (8 species)
    not a true protein
  7. 3005578Species Pea (Pisum sativum) [TaxId:3888] [276208] (9 PDB entries)
  8. 3005587Domain d4rkud_: 4rku D: [309466]
    Other proteins in same PDB: d4rku1_, d4rku3_, d4rku4_, d4rkua_, d4rkub_, d4rkuc_, d4rkue_, d4rkuf_, d4rkuj_, d4rkul_
    automated match to d4y28d_
    complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4

Details for d4rkud_

PDB Entry: 4rku (more details), 3 Å

PDB Description: Crystal structure of plant Photosystem I at 3 Angstrom resolution
PDB Compounds: (D:) photosystem I reaction center subunit II, chloroplastic

SCOPe Domain Sequences for d4rkud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rkud_ d.187.1.1 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
tppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpnll
klarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvnfr
sigknvspievkftgkq

SCOPe Domain Coordinates for d4rkud_:

Click to download the PDB-style file with coordinates for d4rkud_.
(The format of our PDB-style files is described here.)

Timeline for d4rkud_: