![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily) beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail |
![]() | Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) ![]() automatically mapped to Pfam PF02531 |
![]() | Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins) |
![]() | Protein automated matches [236562] (8 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276208] (9 PDB entries) |
![]() | Domain d4rkud_: 4rku D: [309466] Other proteins in same PDB: d4rku1_, d4rku3_, d4rku4_, d4rkua_, d4rkub_, d4rkuc_, d4rkue_, d4rkuf_, d4rkuj_, d4rkul_ automated match to d4y28d_ complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4 |
PDB Entry: 4rku (more details), 3 Å
SCOPe Domain Sequences for d4rkud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rkud_ d.187.1.1 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} tppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpnll klarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvnfr sigknvspievkftgkq
Timeline for d4rkud_: