Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) duplication: contains two structural repeats |
Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
Protein automated matches [276200] (2 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276203] (4 PDB entries) |
Domain d4rku4_: 4rku 4: [309462] Other proteins in same PDB: d4rkua_, d4rkub_, d4rkuc_, d4rkud_, d4rkue_, d4rkuf_, d4rkuj_ automated match to d4y282_ complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4 |
PDB Entry: 4rku (more details), 3 Å
SCOPe Domain Sequences for d4rku4_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rku4_ f.43.1.0 (4:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} kgewlpglaspgyltgslpgdngfdplglaedpenlrwfvqaelvngrwamlgvagmllp evftsigiinvpkwydagkeeyfassstlfviefilfhyveirrwqdiknpgsvnqdpif kqyslpagevgypggifnplnfaptleakekeiangrlamlaflgfiiqhnvtgkgpfdn llqhisdpwhntivqt
Timeline for d4rku4_: