Lineage for d4rku4_ (4rku 4:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256154Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 2256155Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 2256178Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 2256179Protein automated matches [276200] (2 species)
    not a true protein
  7. 2256180Species Pea (Pisum sativum) [TaxId:3888] [276203] (4 PDB entries)
  8. 2256196Domain d4rku4_: 4rku 4: [309462]
    Other proteins in same PDB: d4rkua_, d4rkub_, d4rkuc_, d4rkud_, d4rkue_, d4rkuf_, d4rkuj_
    automated match to d4y282_
    complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4

Details for d4rku4_

PDB Entry: 4rku (more details), 3 Å

PDB Description: Crystal structure of plant Photosystem I at 3 Angstrom resolution
PDB Compounds: (4:) chlorophyll a-b binding protein p4, chloroplastic

SCOPe Domain Sequences for d4rku4_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rku4_ f.43.1.0 (4:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
kgewlpglaspgyltgslpgdngfdplglaedpenlrwfvqaelvngrwamlgvagmllp
evftsigiinvpkwydagkeeyfassstlfviefilfhyveirrwqdiknpgsvnqdpif
kqyslpagevgypggifnplnfaptleakekeiangrlamlaflgfiiqhnvtgkgpfdn
llqhisdpwhntivqt

SCOPe Domain Coordinates for d4rku4_:

Click to download the PDB-style file with coordinates for d4rku4_.
(The format of our PDB-style files is described here.)

Timeline for d4rku4_: