SCOPe 2.07: Domain d4rija1: 4rij A:12-244

Lineage for d4rija1 (4rij A:12-244)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.0: automated matches [227144] (1 protein)
   not a true family

6. Protein automated matches [226847] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [271217] (3 PDB entries)

8. Domain d4rija1: 4rij A:12-244 [309456]
   Other proteins in same PDB: d4rija2
   automated match to d4wpta1
   complexed with gdp, gol, mn, po4, zn

Details for d4rija1

PDB Entry: 4rij, 2.12 Å

PDB Description: crystal structure of the mtb phosphoenolpyruvate carboxykinase(pepck) in complex with gdp and metals

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d4rija1:

Sequence; same for both SEQRES and ATOM records:

>d4rija1 c.109.1.0 (A:12-244) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
aptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfirlnpekhknsyl
alsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrgcmrgrtmyvvpfc
mgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkalhsvgaplepgq
kdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasamahdeg

Timeline for d4rija1:

• d4rija1 first appeared in SCOPe 2.06
  
• d4rija1 appears in the current release, SCOPe 2.08