Lineage for d4rija1 (4rij A:12-244)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920699Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2920700Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2920813Family c.109.1.0: automated matches [227144] (1 protein)
    not a true family
  6. 2920814Protein automated matches [226847] (5 species)
    not a true protein
  7. 2920845Species Mycobacterium tuberculosis [TaxId:83332] [271217] (3 PDB entries)
  8. 2920847Domain d4rija1: 4rij A:12-244 [309456]
    Other proteins in same PDB: d4rija2
    automated match to d4wpta1
    complexed with gdp, gol, mn, po4, zn

Details for d4rija1

PDB Entry: 4rij (more details), 2.12 Å

PDB Description: crystal structure of the mtb phosphoenolpyruvate carboxykinase(pepck) in complex with gdp and metals
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d4rija1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rija1 c.109.1.0 (A:12-244) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
aptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfirlnpekhknsyl
alsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrgcmrgrtmyvvpfc
mgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkalhsvgaplepgq
kdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasamahdeg

SCOPe Domain Coordinates for d4rija1:

Click to download the PDB-style file with coordinates for d4rija1.
(The format of our PDB-style files is described here.)

Timeline for d4rija1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rija2