Lineage for d4riha_ (4rih A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2142590Species Streptomyces cyanogenus [TaxId:80860] [311430] (5 PDB entries)
  8. 2142599Domain d4riha_: 4rih A: [309449]
    Other proteins in same PDB: d4rihb2
    automated match to d2p6pa_
    complexed with 3r2, mg

Details for d4riha_

PDB Entry: 4rih (more details), 2.22 Å

PDB Description: chimeric glycosyltransferase langt2s8ac, carbasugar substrate complex
PDB Compounds: (A:) Glycosyl transferase homolog

SCOPe Domain Sequences for d4riha_:

Sequence, based on SEQRES records: (download)

>d4riha_ c.87.1.0 (A:) automated matches {Streptomyces cyanogenus [TaxId: 80860]}
mkilfvaagspatvfalaplataarnaghdvfmgavedmvpyiasagipavattdlpirh
fitmdregnpvrmpetpeeeldfaghwfgrmaagsmdalrevtanwrpdlvvggsmsfaa
aliaaelgvpyvrqawdtgdawrtdpaasdelrpelralgldrlpdpalfvdicppslrp
adappaqmmrwvpangqrrlepwmytkgnrprilvtsgsrlvfakktgflrglvadmaal
daevviatldevaeelrtelpgvragwvpldvvvptcdvvvhhaggvtaltamnagvpql
ivpqggnfveaglrisdfgaaitvdentpeavekacgelignpsyaerarelsaeiaalp
lpaevvgaleglv

Sequence, based on observed residues (ATOM records): (download)

>d4riha_ c.87.1.0 (A:) automated matches {Streptomyces cyanogenus [TaxId: 80860]}
mkilfvaagspatvfalaplataarnaghdvfmgavedmvpyiasagipavattdlpirh
fitmdregnpvrmpetpeeeldfaghwfgrmaagsmdalrevtanwrpdlvvggsmsfaa
aliaaelgvpyvrqawdtgdawrtdpaasdelrpelralgldrlpdpalfvdicppslrp
adappaqmmrwvpangqrrlepwmytkgnrprilvtsgsrlvfakktgflrglvadmaal
daevviatldevaeelgvragwvpldvvvptcdvvvhhaggvtaltamnagvpqlivpqg
gnfveaglrisdfgaaitvdentpeavekacgelignpsyaerarelsaeiaalplpaev
vgaleglv

SCOPe Domain Coordinates for d4riha_:

Click to download the PDB-style file with coordinates for d4riha_.
(The format of our PDB-style files is described here.)

Timeline for d4riha_:

  • d4riha_ is new in SCOPe 2.06-stable