Lineage for d4riga1 (4rig A:1-373)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2142590Species Streptomyces cyanogenus [TaxId:80860] [311430] (5 PDB entries)
  8. 2142593Domain d4riga1: 4rig A:1-373 [309445]
    Other proteins in same PDB: d4riga2, d4rigb2
    automated match to d2p6pa_
    complexed with mg

Details for d4riga1

PDB Entry: 4rig (more details), 1.9 Å

PDB Description: chimeric glycosyltransferase langt2s8ac
PDB Compounds: (A:) glycosyl transferase

SCOPe Domain Sequences for d4riga1:

Sequence, based on SEQRES records: (download)

>d4riga1 c.87.1.0 (A:1-373) automated matches {Streptomyces cyanogenus [TaxId: 80860]}
mkilfvaagspatvfalaplataarnaghdvfmgavedmvpyiasagipavattdlpirh
fitmdregnpvrmpetpeeeldfaghwfgrmaagsmdalrevtanwrpdlvvggsmsfaa
aliaaelgvpyvrqawdtgdawrtdpaasdelrpelralgldrlpdpalfvdicppslrp
adappaqmmrwvpangqrrlepwmytkgnrprilvtsgsrlvfakktgflrglvadmaal
daevviatldevaeelrtelpgvragwvpldvvvptcdvvvhhaggvtaltamnagvpql
ivpqggnfveaglrisdfgaaitvdentpeavekacgelignpsyaerarelsaeiaalp
lpaevvgaleglv

Sequence, based on observed residues (ATOM records): (download)

>d4riga1 c.87.1.0 (A:1-373) automated matches {Streptomyces cyanogenus [TaxId: 80860]}
mkilfvaagspatvfalaplataarnaghdvfmgavedmvpyiasagipavattdlpirh
fitmdregnpvrmpetpeeeldfaghwfgrmaagsmdalrevtanwrpdlvvggsmsfaa
aliaaelgvpyvrqawdtgdawrtdpaasdelrpelralgldrlpdpalfvdicppslrp
adappaqmmrwvpangqrrlepwmytkgnrprilvtsadmaaldaevviatlvragwvpl
dvvvptcdvvvhhaggvtaltamnagvpqlivpqggnfveaglrisdfgaaitvdentpe
avekacgelignpsyaerarelsaeiaalplpaevvgaleglv

SCOPe Domain Coordinates for d4riga1:

Click to download the PDB-style file with coordinates for d4riga1.
(The format of our PDB-style files is described here.)

Timeline for d4riga1:

  • d4riga1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4riga2