Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) |
Family c.87.1.0: automated matches [191559] (1 protein) not a true family |
Protein automated matches [190965] (26 species) not a true protein |
Species Streptomyces cyanogenus [TaxId:80860] [311430] (5 PDB entries) |
Domain d4rifb1: 4rif B:1-373 [309443] Other proteins in same PDB: d4rifa2, d4rifb2 automated match to d2p6pa_ complexed with 3r2 |
PDB Entry: 4rif (more details), 1.85 Å
SCOPe Domain Sequences for d4rifb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rifb1 c.87.1.0 (B:1-373) automated matches {Streptomyces cyanogenus [TaxId: 80860]} mkilfvasgspatvfalaplataarnaghdvfmgavedmvpyiasagipalsiapssirr yatmdregnpvrmpetpeeeldfaghwfgrmaagsmdalrevtanwrpdlvvggsmsfaa aliaaelgvpyvrqawdtgdawrtdpaasdelrpelralgldrlpdpalfvdicppslrp atappaqmmrwvpangqrrlepwmytkgnrprilvtsgsrlvfakktgflrglvadmaal daevviatldevaeelrtelpgvragwvpldvvvptcdvvvhhaggvtaltamnagvpql ivpqggnfveaglrisdfgaaitvdentpeavekacgelignpsyaerarelsaeiaalp lpaevvgaleglv
Timeline for d4rifb1: