SCOPe 2.06: Domain d4rifb1: 4rif B:1-373

Lineage for d4rifb1 (4rif B:1-373)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.0: automated matches [191559] (1 protein)
   not a true family

6. Protein automated matches [190965] (26 species)
   not a true protein

7. Species Streptomyces cyanogenus [TaxId:80860] [311430] (5 PDB entries)

8. Domain d4rifb1: 4rif B:1-373 [309443]
   Other proteins in same PDB: d4rifa2, d4rifb2
   automated match to d2p6pa_
   complexed with 3r2

Details for d4rifb1

PDB Entry: 4rif, 1.85 Å

PDB Description: landomycin glycosyltransferase langt2, carbasugar substrate complex

PDB Compounds: (B:) Glycosyl transferase homolog

SCOPe Domain Sequences for d4rifb1:

Sequence; same for both SEQRES and ATOM records:

>d4rifb1 c.87.1.0 (B:1-373) automated matches {Streptomyces cyanogenus [TaxId: 80860]}
mkilfvasgspatvfalaplataarnaghdvfmgavedmvpyiasagipalsiapssirr
yatmdregnpvrmpetpeeeldfaghwfgrmaagsmdalrevtanwrpdlvvggsmsfaa
aliaaelgvpyvrqawdtgdawrtdpaasdelrpelralgldrlpdpalfvdicppslrp
atappaqmmrwvpangqrrlepwmytkgnrprilvtsgsrlvfakktgflrglvadmaal
daevviatldevaeelrtelpgvragwvpldvvvptcdvvvhhaggvtaltamnagvpql
ivpqggnfveaglrisdfgaaitvdentpeavekacgelignpsyaerarelsaeiaalp
lpaevvgaleglv

Timeline for d4rifb1:

• d4rifb1 is new in SCOPe 2.06-stable
  
• d4rifb1 appears in SCOPe 2.07
  
• d4rifb1 appears in the current release, SCOPe 2.08