Lineage for d4rifb1 (4rif B:1-373)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2911058Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2911059Protein automated matches [190965] (40 species)
    not a true protein
  7. 2911255Species Streptomyces cyanogenus [TaxId:80860] [311430] (5 PDB entries)
  8. 2911257Domain d4rifb1: 4rif B:1-373 [309443]
    Other proteins in same PDB: d4rifa2, d4rifb2
    automated match to d2p6pa_
    complexed with 3r2

Details for d4rifb1

PDB Entry: 4rif (more details), 1.85 Å

PDB Description: landomycin glycosyltransferase langt2, carbasugar substrate complex
PDB Compounds: (B:) Glycosyl transferase homolog

SCOPe Domain Sequences for d4rifb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rifb1 c.87.1.0 (B:1-373) automated matches {Streptomyces cyanogenus [TaxId: 80860]}
mkilfvasgspatvfalaplataarnaghdvfmgavedmvpyiasagipalsiapssirr
yatmdregnpvrmpetpeeeldfaghwfgrmaagsmdalrevtanwrpdlvvggsmsfaa
aliaaelgvpyvrqawdtgdawrtdpaasdelrpelralgldrlpdpalfvdicppslrp
atappaqmmrwvpangqrrlepwmytkgnrprilvtsgsrlvfakktgflrglvadmaal
daevviatldevaeelrtelpgvragwvpldvvvptcdvvvhhaggvtaltamnagvpql
ivpqggnfveaglrisdfgaaitvdentpeavekacgelignpsyaerarelsaeiaalp
lpaevvgaleglv

SCOPe Domain Coordinates for d4rifb1:

Click to download the PDB-style file with coordinates for d4rifb1.
(The format of our PDB-style files is described here.)

Timeline for d4rifb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rifb2