Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) |
Family c.34.1.0: automated matches [191535] (1 protein) not a true family |
Protein automated matches [190910] (10 species) not a true protein |
Species Colwellia psychrerythraea [TaxId:167879] [311428] (2 PDB entries) |
Domain d4rhfa_: 4rhf A: [309436] automated match to d3zqua_ complexed with so4; mutant |
PDB Entry: 4rhf (more details), 1.76 Å
SCOPe Domain Sequences for d4rhfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rhfa_ c.34.1.0 (A:) automated matches {Colwellia psychrerythraea [TaxId: 167879]} dfngkitlaitgasgasyamrliecliaanyqlyilcssagrisldtevgvkipsspdaa skfltekyqakdqqitvfgkeqwfspvasgssapkqmvvcpcstgtmaaichgmsdnlie raadvvikergqlilmvretpfstlhlqnmlslsqqgvtimpaspgfyhkvetiedlidf mvgrvldhlgieqdimprwg
Timeline for d4rhfa_: