| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) ![]() |
| Family c.34.1.0: automated matches [191535] (1 protein) not a true family |
| Protein automated matches [190910] (10 species) not a true protein |
| Species Colwellia psychrerythraea [TaxId:167879] [311428] (2 PDB entries) |
| Domain d4rhee_: 4rhe E: [309434] automated match to d4zava_ complexed with fmn, so4 |
PDB Entry: 4rhe (more details), 2 Å
SCOPe Domain Sequences for d4rhee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rhee_ c.34.1.0 (E:) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
dfngkitlaitgasgasyamrliecliaanyqlyilcssagrivldtevgvkipsspdaa
skfltekyqakdqqitvfgkeqwfspvasgssapkqmvvcpcstgtmaaichgmsdnlie
raadvvikergqlilmvretpfstlhlqnmlslsqqgvtimpaspgfyhkvetiedlidf
mvgrvldhlgieqdimprwgyn
Timeline for d4rhee_: