Lineage for d4rhea_ (4rhe A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864431Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864432Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 2864471Family c.34.1.0: automated matches [191535] (1 protein)
    not a true family
  6. 2864472Protein automated matches [190910] (10 species)
    not a true protein
  7. 2864485Species Colwellia psychrerythraea [TaxId:167879] [311428] (2 PDB entries)
  8. 2864487Domain d4rhea_: 4rhe A: [309430]
    automated match to d4zava_
    complexed with fmn, so4

Details for d4rhea_

PDB Entry: 4rhe (more details), 2 Å

PDB Description: Crystal structure of UbiX, an aromatic acid decarboxylase from the Colwellia psychrerythraea 34H
PDB Compounds: (A:) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

SCOPe Domain Sequences for d4rhea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rhea_ c.34.1.0 (A:) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
dfngkitlaitgasgasyamrliecliaanyqlyilcssagrivldtevgvkipsspdaa
skfltekyqakdqqitvfgkeqwfspvasgssapkqmvvcpcstgtmaaichgmsdnlie
raadvvikergqlilmvretpfstlhlqnmlslsqqgvtimpaspgfyhkvetiedlidf
mvgrvldhlgieqdimprwgyn

SCOPe Domain Coordinates for d4rhea_:

Click to download the PDB-style file with coordinates for d4rhea_.
(The format of our PDB-style files is described here.)

Timeline for d4rhea_: