Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (2 families) |
Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
Protein Lumazine synthase [52123] (7 species) |
Species Bacillus subtilis [TaxId:1423] [52124] (2 PDB entries) beta-subunit of the lumazine synthase/riboflavin synthase complex; 60 subunits form an icosahedral shell |
Domain d1rvvq_: 1rvv Q: [30943] complexed with ini, po4 |
PDB Entry: 1rvv (more details), 2.4 Å
SCOPe Domain Sequences for d1rvvq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rvvq_ c.16.1.1 (Q:) Lumazine synthase {Bacillus subtilis [TaxId: 1423]} mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten ieqaieragtkagnkgvdcavsaiemanlnrsfe
Timeline for d1rvvq_:
View in 3D Domains from other chains: (mouse over for more information) d1rvv1_, d1rvv2_, d1rvv3_, d1rvv4_, d1rvva_, d1rvvb_, d1rvvc_, d1rvvd_, d1rvve_, d1rvvf_, d1rvvg_, d1rvvh_, d1rvvi_, d1rvvj_, d1rvvk_, d1rvvl_, d1rvvm_, d1rvvn_, d1rvvo_, d1rvvp_, d1rvvr_, d1rvvs_, d1rvvt_, d1rvvu_, d1rvvv_, d1rvvw_, d1rvvx_, d1rvvy_, d1rvvz_ |