Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
Protein automated matches [226841] (5 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [226095] (2 PDB entries) |
Domain d4rh6a2: 4rh6 A:126-226 [309425] Other proteins in same PDB: d4rh6a1, d4rh6b1, d4rh6c1 automated match to d4o1na2 complexed with cl |
PDB Entry: 4rh6 (more details), 2.9 Å
SCOPe Domain Sequences for d4rh6a2:
Sequence, based on SEQRES records: (download)
>d4rh6a2 d.15.6.0 (A:126-226) automated matches {Staphylococcus aureus [TaxId: 93062]} qyidyintpileikkdnedvlkdfyyiskedislkeldyrlreraikqhglysnglkqgq ititmndgtthtidlsqklekermgesidgtkinkilvemk
>d4rh6a2 d.15.6.0 (A:126-226) automated matches {Staphylococcus aureus [TaxId: 93062]} qyidyintpileikkddvlkdfyyiskedislkeldyrlreraikqhglysnglkqgqit itmndgtthtidlsqklekermgesidgtkinkilvemk
Timeline for d4rh6a2:
View in 3D Domains from other chains: (mouse over for more information) d4rh6b1, d4rh6b2, d4rh6c1, d4rh6c2 |