Lineage for d4reza2 (4rez A:1543-1803)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927545Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2927546Protein Papain-like protease PLpro, catalytic domain [310795] (4 species)
  7. 2927557Species Human betacoronavirus 2c jordan-n3/2012 [TaxId:1306931] [311427] (3 PDB entries)
  8. 2927559Domain d4reza2: 4rez A:1543-1803 [309422]
    Other proteins in same PDB: d4reza1
    automated match to d4p16a2
    complexed with pgo, zn

Details for d4reza2

PDB Entry: 4rez (more details), 2.8 Å

PDB Description: Crystal structure of the Middle-East respiratory syndrome coronavirus papain-like protease
PDB Compounds: (A:) ORF1ab protein

SCOPe Domain Sequences for d4reza2:

Sequence, based on SEQRES records: (download)

>d4reza2 d.3.1.23 (A:1543-1803) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyssdcn

Sequence, based on observed residues (ATOM records): (download)

>d4reza2 d.3.1.23 (A:1543-1803) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttapdfvafnvfqgghyvharlklilkfdsgtvsktsdwkckvtdv
lfpgqkyssdcn

SCOPe Domain Coordinates for d4reza2:

Click to download the PDB-style file with coordinates for d4reza2.
(The format of our PDB-style files is described here.)

Timeline for d4reza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4reza1