SCOPe 2.06: Domain d1rvvo_: 1rvv O:

Lineage for d1rvvo_ (1rvv O:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.16: Lumazine synthase [52120] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.16.1: Lumazine synthase [52121] (2 families)

5. Family c.16.1.1: Lumazine synthase [52122] (2 proteins)

6. Protein Lumazine synthase [52123] (7 species)

7. Species Bacillus subtilis [TaxId:1423] [52124] (2 PDB entries)
   beta-subunit of the lumazine synthase/riboflavin synthase complex; 60 subunits form an icosahedral shell

8. Domain d1rvvo_: 1rvv O: [30941]
   complexed with ini, po4

Details for d1rvvo_

PDB Entry: 1rvv, 2.4 Å

PDB Description: synthase/riboflavin synthase complex of bacillus subtilis

PDB Compounds: (O:) riboflavin synthase

SCOPe Domain Sequences for d1rvvo_:

Sequence; same for both SEQRES and ATOM records:

>d1rvvo_ c.16.1.1 (O:) Lumazine synthase {Bacillus subtilis [TaxId: 1423]}
mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
ieqaieragtkagnkgvdcavsaiemanlnrsfe

Timeline for d1rvvo_:

• d1rvvo_ first appeared (with stable ids) in SCOP 1.55
  
• d1rvvo_ appears in SCOPe 2.05
  
• d1rvvo_ appears in SCOPe 2.07
  
• d1rvvo_ appears in the current release, SCOPe 2.08