Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.16: beta-subunit of the lumazine synthase/riboflavin synthase complex [52120] (1 superfamily) |
Superfamily c.16.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52121] (1 family) |
Family c.16.1.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52122] (1 protein) |
Protein beta-subunit of the lumazine synthase/riboflavin synthase complex [52123] (4 species) |
Species Bacillus subtilis [TaxId:1423] [52124] (1 PDB entry) |
Domain d1rvvm_: 1rvv M: [30939] |
PDB Entry: 1rvv (more details), 2.4 Å
SCOP Domain Sequences for d1rvvm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rvvm_ c.16.1.1 (M:) beta-subunit of the lumazine synthase/riboflavin synthase complex {Bacillus subtilis} mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten ieqaieragtkagnkgvdcavsaiemanlnrsfe
Timeline for d1rvvm_:
View in 3D Domains from other chains: (mouse over for more information) d1rvv1_, d1rvv2_, d1rvv3_, d1rvv4_, d1rvva_, d1rvvb_, d1rvvc_, d1rvvd_, d1rvve_, d1rvvf_, d1rvvg_, d1rvvh_, d1rvvi_, d1rvvj_, d1rvvk_, d1rvvl_, d1rvvn_, d1rvvo_, d1rvvp_, d1rvvq_, d1rvvr_, d1rvvs_, d1rvvt_, d1rvvu_, d1rvvv_, d1rvvw_, d1rvvx_, d1rvvy_, d1rvvz_ |