Lineage for d4r3da2 (4r3d A:63-326)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155396Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 protein domains)
    C-terminal part of Pfam PF08715
  6. 2155410Protein automated matches [310868] (5 species)
    not a true protein
  7. 2155411Species Betacoronavirus england 1 [TaxId:1263720] [311420] (1 PDB entry)
  8. 2155412Domain d4r3da2: 4r3d A:63-326 [309356]
    Other proteins in same PDB: d4r3da1, d4r3db1
    automated match to d4p16a2
    complexed with zn

Details for d4r3da2

PDB Entry: 4r3d (more details), 2.82 Å

PDB Description: crystal structure of mers coronavirus papain like protease
PDB Compounds: (A:) non-structural protein 3

SCOPe Domain Sequences for d4r3da2:

Sequence, based on SEQRES records: (download)

>d4r3da2 d.3.1.23 (A:63-326) automated matches {Betacoronavirus england 1 [TaxId: 1263720]}
adetkalkelygpvdptflhrfyslkaavhkwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqivehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyssdcnvvr

Sequence, based on observed residues (ATOM records): (download)

>d4r3da2 d.3.1.23 (A:63-326) automated matches {Betacoronavirus england 1 [TaxId: 1263720]}
adetkalkelygpvdptflhrfyslkaavhkwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqivehtt
pwlllsgtpneklvttstapdfvafnvfqgghyvharlkgglilkfdsgtvsktsdwkck
vtdvlfpgqkyssdcnvvr

SCOPe Domain Coordinates for d4r3da2:

Click to download the PDB-style file with coordinates for d4r3da2.
(The format of our PDB-style files is described here.)

Timeline for d4r3da2:

  • d4r3da2 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4r3da1