| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
| Protein automated matches [190233] (22 species) not a true protein |
| Species Betacoronavirus england 1 [TaxId:1263720] [311419] (1 PDB entry) |
| Domain d4r3da1: 4r3d A:3-62 [309355] Other proteins in same PDB: d4r3da2, d4r3db2 automated match to d4p16a1 complexed with zn |
PDB Entry: 4r3d (more details), 2.82 Å
SCOPe Domain Sequences for d4r3da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r3da1 d.15.1.0 (A:3-62) automated matches {Betacoronavirus england 1 [TaxId: 1263720]}
ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt
Timeline for d4r3da1: