Lineage for d4r2ma_ (4r2m A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2443548Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2443822Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2443823Protein automated matches [190116] (26 species)
    not a true protein
  7. 2443919Species Salmonella enterica [TaxId:99287] [311418] (2 PDB entries)
  8. 2443922Domain d4r2ma_: 4r2m A: [309352]
    automated match to d2pfsa_
    complexed with anp, mg; mutant

Details for d4r2ma_

PDB Entry: 4r2m (more details), 2.2 Å

PDB Description: Crystal Structure of R134D mutant of YnaF (Universal Stress Protein F) from Salmonella typhimurium
PDB Compounds: (A:) Universal stress protein F

SCOPe Domain Sequences for d4r2ma_:

Sequence, based on SEQRES records: (download)

>d4r2ma_ c.26.2.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
nrtilvpidisdseltqrvishveaeakiddakvhfltvipslpyyaslglaysaelpam
ddlkaeaksqleaiikkfnlpadrvqahvaegspkdkilemakklpadmviiashrpdit
tyllgsnaaavvdhaecsvlvvr

Sequence, based on observed residues (ATOM records): (download)

>d4r2ma_ c.26.2.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
nrtilvpidisdseltqrvishveaeakiddakvhfltvipslpyyaslglasaelpamd
dlkaeaksqleaiikkfnlpadrvqahvaegspkdkilemakklpadmviiashrpditt
yllgsnaaavvdhaecsvlvvr

SCOPe Domain Coordinates for d4r2ma_:

Click to download the PDB-style file with coordinates for d4r2ma_.
(The format of our PDB-style files is described here.)

Timeline for d4r2ma_: