SCOPe 2.08: Domain d4r2ma_: 4r2m A:

Lineage for d4r2ma_ (4r2m A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (28 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [311418] (2 PDB entries)

8. Domain d4r2ma_: 4r2m A: [309352]
   automated match to d2pfsa_
   complexed with anp, mg; mutant

Details for d4r2ma_

PDB Entry: 4r2m, 2.2 Å

PDB Description: crystal structure of r134d mutant of ynaf (universal stress protein f) from salmonella typhimurium

PDB Compounds: (A:) Universal stress protein F

SCOPe Domain Sequences for d4r2ma_:

Sequence, based on SEQRES records:

>d4r2ma_ c.26.2.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
nrtilvpidisdseltqrvishveaeakiddakvhfltvipslpyyaslglaysaelpam
ddlkaeaksqleaiikkfnlpadrvqahvaegspkdkilemakklpadmviiashrpdit
tyllgsnaaavvdhaecsvlvvr

Sequence, based on observed residues (ATOM records):

>d4r2ma_ c.26.2.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
nrtilvpidisdseltqrvishveaeakiddakvhfltvipslpyyaslglasaelpamd
dlkaeaksqleaiikkfnlpadrvqahvaegspkdkilemakklpadmviiashrpditt
yllgsnaaavvdhaecsvlvvr

Timeline for d4r2ma_:

• d4r2ma_ first appeared in SCOPe 2.06
  
• d4r2ma_ appears in SCOPe 2.07