Lineage for d4r2lb_ (4r2l B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861542Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2861543Protein automated matches [190116] (28 species)
    not a true protein
  7. 2861666Species Salmonella enterica [TaxId:99287] [311418] (2 PDB entries)
  8. 2861668Domain d4r2lb_: 4r2l B: [309351]
    automated match to d2pfsa_
    complexed with atp, cl, edo, mg

Details for d4r2lb_

PDB Entry: 4r2l (more details), 1.8 Å

PDB Description: crystal structure of ynaf (universal stress protein f) from salmonella typhimurium
PDB Compounds: (B:) Universal stress protein F

SCOPe Domain Sequences for d4r2lb_:

Sequence, based on SEQRES records: (download)

>d4r2lb_ c.26.2.0 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
nrtilvpidisdseltqrvishveaeakiddakvhfltvipslpyyaslglaysaelpam
ddlkaeaksqleaiikkfnlpadrvqahvaegspkdkilemakklpadmviiashrpdit
tyllgsnaaavvrhaecsvlvvr

Sequence, based on observed residues (ATOM records): (download)

>d4r2lb_ c.26.2.0 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
nrtilvpidisdseltqrvishveaeakiddakvhfltvipslpyyaslgpamddlkaea
ksqleaiikkfnlpadrvqahvaegspkdkilemakklpadmviiashrpdittyllgsn
aaavvrhaecsvlvvr

SCOPe Domain Coordinates for d4r2lb_:

Click to download the PDB-style file with coordinates for d4r2lb_.
(The format of our PDB-style files is described here.)

Timeline for d4r2lb_: