| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
| Protein automated matches [190116] (28 species) not a true protein |
| Species Salmonella enterica [TaxId:99287] [311418] (2 PDB entries) |
| Domain d4r2la_: 4r2l A: [309350] automated match to d2pfsa_ complexed with atp, cl, edo, mg |
PDB Entry: 4r2l (more details), 1.8 Å
SCOPe Domain Sequences for d4r2la_:
Sequence, based on SEQRES records: (download)
>d4r2la_ c.26.2.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
nrtilvpidisdseltqrvishveaeakiddakvhfltvipslpyyaslglaysaelpam
ddlkaeaksqleaiikkfnlpadrvqahvaegspkdkilemakklpadmviiashrpdit
tyllgsnaaavvrhaecsvlvvr
>d4r2la_ c.26.2.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
nrtilvpidisdseltqrvishveaeakiddakvhfltvipslpyyaslglasaelpamd
dlkaeaksqleaiikkfnlpadrvqahvaegspkdkilemakklpadmviiashrpditt
yllgsnaaavvrhaecsvlvvr
Timeline for d4r2la_: