SCOPe 2.07: Domain d4r00v_: 4r00 V:

Lineage for d4r00v_ (4r00 V:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4r00v_: 4r00 V: [309344]
   Other proteins in same PDB: d4r00a_, d4r00c_, d4r00d_, d4r00e_, d4r00g_, d4r00i_, d4r00j_, d4r00k_, d4r00l_, d4r00n_, d4r00o_, d4r00q_, d4r00r_, d4r00s_, d4r00u_, d4r00w_, d4r00x_, d4r00y_, d4r00z_
   automated match to d4r17h_
   complexed with cl, mg, sla; mutant

Details for d4r00v_

PDB Entry: 4r00, 2.8 Å

PDB Description: yCP beta5-C52F mutant in complex with Omuralide

PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4r00v_:

Sequence; same for both SEQRES and ATOM records:

>d4r00v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

Timeline for d4r00v_:

• d4r00v_ first appeared in SCOPe 2.06
  
• d4r00v_ appears in the current release, SCOPe 2.08