Lineage for d1rvvd_ (1rvv D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21611Fold c.16: beta-subunit of the lumazine synthase/riboflavin synthase complex [52120] (1 superfamily)
  4. 21612Superfamily c.16.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52121] (1 family) (S)
  5. 21613Family c.16.1.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52122] (1 protein)
  6. 21614Protein beta-subunit of the lumazine synthase/riboflavin synthase complex [52123] (4 species)
  7. 21615Species Bacillus subtilis [TaxId:1423] [52124] (1 PDB entry)
  8. 21623Domain d1rvvd_: 1rvv D: [30930]

Details for d1rvvd_

PDB Entry: 1rvv (more details), 2.4 Å

PDB Description: synthase/riboflavin synthase complex of bacillus subtilis

SCOP Domain Sequences for d1rvvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvvd_ c.16.1.1 (D:) beta-subunit of the lumazine synthase/riboflavin synthase complex {Bacillus subtilis}
mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
ieqaieragtkagnkgvdcavsaiemanlnrsfe

SCOP Domain Coordinates for d1rvvd_:

Click to download the PDB-style file with coordinates for d1rvvd_.
(The format of our PDB-style files is described here.)

Timeline for d1rvvd_: