Lineage for d1cdza_ (1cdz A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.15: BRCT domain [52112] (1 superfamily) Superfamily c.15.1: BRCT domain [52113] (2 families) 
Family c.15.1.1: DNA-repair protein XRCC1 [52114] (1 protein) Protein DNA-repair protein XRCC1 [52115] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52116] (1 PDB entry) 
Domain d1cdza_: 1cdz A: [30925]
Details for d1cdza_
PDB Entry: 1cdz (more details), 3.2 Å
PDB Description: brct domain from dna-repair protein xrcc1
SCOP Domain Sequences for d1cdza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens)}
elpdffqgkhfflygefpgderrkliryvtafngeledymsdrvqfvitaqewdpsfeea
lmdnpslafvrprwiyscnekqkllphqlygvvpqa
SCOP Domain Coordinates for d1cdza_:
Click to download the PDB-style file with coordinates for d1cdza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cdza_:
- d1cdza_ appears in SCOP 1.57
- d1cdza_ appears in the current release, SCOPe 2.08
View in 3D