Lineage for d1ef9a_ (1ef9 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824388Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 824389Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 824543Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 824665Protein Methylmalonyl CoA decarboxylase [52110] (1 species)
  7. 824666Species Escherichia coli [TaxId:562] [52111] (2 PDB entries)
  8. 824670Domain d1ef9a_: 1ef9 A: [30924]
    complexed with 2cp

Details for d1ef9a_

PDB Entry: 1ef9 (more details), 2.7 Å

PDB Description: the crystal structure of methylmalonyl coa decarboxylase complexed with 2s-carboxypropyl coa
PDB Compounds: (A:) methylmalonyl coa decarboxylase

SCOP Domain Sequences for d1ef9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef9a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]}
msyqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgsk
vfsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdl
iiaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnh
vveveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravyds
edyqegmnaflekrkpnfvgh

SCOP Domain Coordinates for d1ef9a_:

Click to download the PDB-style file with coordinates for d1ef9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ef9a_: